SCOPe 2.02: Domain d1obub_: 1obu B:

Lineage for d1obub_ (1obu B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Alpha-crustacyanin [63807] (1 species)

7. Species European lobster (Homarus gammarus) [TaxId:6707] [63808] (7 PDB entries)

8. Domain d1obub_: 1obu B: [86781]

Details for d1obub_

PDB Entry: 1obu, 2 Å

PDB Description: apocrustacyanin c1 crystals grown in space and earth using vapour diffusion geometry

PDB Compounds: (B:) crustacyanin c1 subunit

SCOPe Domain Sequences for d1obub_:

Sequence; same for both SEQRES and ATOM records:

>d1obub_ b.60.1.1 (B:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]}
kipdfvvpgkcasvdrnklwaeqtpnrnsyagvwyqfaltnnpyqliekcvrneysfdgk
qfviestgiaydgnllkrngklypnpfgephlsidyensfaaplviletdysnyaclysc
idynfgyhsdfsfifsrsanladqyvkkceaafkninvdttrfvktvqgsscpydtqktl

Timeline for d1obub_:

• d1obub_ first appeared in SCOP 1.65
  
• d1obub_ appears in SCOPe 2.01
  
• d1obub_ appears in SCOPe 2.03
  
• d1obub_ appears in the current release, SCOPe 2.08