Lineage for d1obub_ (1obu B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957981Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 957982Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 957983Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 957984Protein Alpha-crustacyanin [63807] (1 species)
  7. 957985Species European lobster (Homarus gammarus) [TaxId:6707] [63808] (7 PDB entries)
  8. 957997Domain d1obub_: 1obu B: [86781]

Details for d1obub_

PDB Entry: 1obu (more details), 2 Å

PDB Description: apocrustacyanin c1 crystals grown in space and earth using vapour diffusion geometry
PDB Compounds: (B:) crustacyanin c1 subunit

SCOPe Domain Sequences for d1obub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1obub_ b.60.1.1 (B:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]}
kipdfvvpgkcasvdrnklwaeqtpnrnsyagvwyqfaltnnpyqliekcvrneysfdgk
qfviestgiaydgnllkrngklypnpfgephlsidyensfaaplviletdysnyaclysc
idynfgyhsdfsfifsrsanladqyvkkceaafkninvdttrfvktvqgsscpydtqktl

SCOPe Domain Coordinates for d1obub_:

Click to download the PDB-style file with coordinates for d1obub_.
(The format of our PDB-style files is described here.)

Timeline for d1obub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1obua_