Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.2: AglA-like glucosidase [90050] (5 proteins) family 4 glycosyl hydrolase automatically mapped to Pfam PF11975 |
Protein Alpha-glucosidase AglA [90051] (1 species) |
Species Thermotoga maritima [TaxId:2336] [90052] (1 PDB entry) TM1834 |
Domain d1obbb2: 1obb B:173-480 [86763] Other proteins in same PDB: d1obba1, d1obbb1 complexed with mal, nad |
PDB Entry: 1obb (more details), 1.9 Å
SCOPe Domain Sequences for d1obbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1obbb2 d.162.1.2 (B:173-480) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} fchghygvmeiveklgleeekvdwqvagvnhgiwlnrfrynggnayplldkwieekskdw kpenpfndqlspaaidmyrfygvmpigdtvrnsswryhrdletkkkwygepwggadseig wkwyqdtlgkvteitkkvakfikenpsvrlsdlgsvlgkdlsekqfvlevekildperks geqhipfidallndnkarfvvnipnkgiihgidddvvvevpalvdkngihpekiepplpd rvvkyylrprimrmemaleafltgdiriikellyrdprtksdeqvekvieeilalpenee mrkhylkr
Timeline for d1obbb2: