Lineage for d1obbb2 (1obb B:173-480)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 336217Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 336218Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 336353Family d.162.1.2: Alpha-glucosidase AglA [90050] (1 protein)
  6. 336354Protein Alpha-glucosidase AglA [90051] (1 species)
  7. 336355Species Thermotoga maritima [TaxId:243274] [90052] (1 PDB entry)
  8. 336357Domain d1obbb2: 1obb B:173-480 [86763]
    Other proteins in same PDB: d1obba1, d1obbb1
    complexed with csw, mal, nad

Details for d1obbb2

PDB Entry: 1obb (more details), 1.9 Å

PDB Description: alpha-glucosidase a, agla, from thermotoga maritima in complex with maltose and nad+

SCOP Domain Sequences for d1obbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1obbb2 d.162.1.2 (B:173-480) Alpha-glucosidase AglA {Thermotoga maritima}
fchghygvmeiveklgleeekvdwqvagvnhgiwlnrfrynggnayplldkwieekskdw
kpenpfndqlspaaidmyrfygvmpigdtvrnsswryhrdletkkkwygepwggadseig
wkwyqdtlgkvteitkkvakfikenpsvrlsdlgsvlgkdlsekqfvlevekildperks
geqhipfidallndnkarfvvnipnkgiihgidddvvvevpalvdkngihpekiepplpd
rvvkyylrprimrmemaleafltgdiriikellyrdprtksdeqvekvieeilalpenee
mrkhylkr

SCOP Domain Coordinates for d1obbb2:

Click to download the PDB-style file with coordinates for d1obbb2.
(The format of our PDB-style files is described here.)

Timeline for d1obbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1obbb1