SCOPe 2.01: Domain d1oaja_: 1oaj A:

Lineage for d1oaja_ (1oaj A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Photobacterium leiognathi [TaxId:553611] [49337] (9 PDB entries)

8. Domain d1oaja_: 1oaj A: [86738]
   complexed with cu, zn

Details for d1oaja_

PDB Entry: 1oaj, 1.73 Å

PDB Description: active site copper and zinc ions modulate the quaternary structure of prokaryotic cu,zn superoxide dismutase

PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d1oaja_:

Sequence; same for both SEQRES and ATOM records:

>d1oaja_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]}
qdltvkmtdlqtgkpvgtielsqndygvvfipeladltpgmhgfhihqngscassekdgk
vvlggaagghydpehtnkhgfpwtddnhkgdlpalfvsanglatnpvlaprltlkelkgh
aimihaggdnhsdmpkalggggarvacgviq

Timeline for d1oaja_:

• d1oaja_ first appeared in SCOP 1.65
  
• d1oaja_ appears in SCOP 1.75
  
• d1oaja_ appears in SCOPe 2.02
  
• d1oaja_ appears in the current release, SCOPe 2.08