PDB entry 1oaj

View 1oaj on RCSB PDB site
Description: active site copper and zinc ions modulate the quaternary structure of prokaryotic cu,zn superoxide dismutase
Class: oxidoreductase
Keywords: oxidoreductase, prokariotic cu, zn superoxide dismutase, subunit interaction recognition, protein electrostatic
Deposited on 2003-01-14, released 2003-02-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.191
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: superoxide dismutase
  Species: Photobacterium leiognathi [TaxId:658]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00446 (0-150)
    • engineered mutation (24)
    • conflict (30)
  Domains in SCOPe 2.01: d1oaja_
• Heterogens: ZN, CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1oajA (A:)
  qdltvkmtdlqtgkpvgtielsqndygvvfipeladltpgmhgfhihqngscassekdgk
  vvlggaagghydpehtnkhgfpwtddnhkgdlpalfvsanglatnpvlaprltlkelkgh
  aimihaggdnhsdmpkalggggarvacgviq