Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein N-terminal, Prx domain of Hybrid-Prx5 [89708] (1 species) |
Species Haemophilus influenzae [TaxId:727] [89709] (1 PDB entry) HI0572 |
Domain d1nm3b2: 1nm3 B:3-165 [85869] Other proteins in same PDB: d1nm3a1, d1nm3b1 complexed with so4 |
PDB Entry: 1nm3 (more details), 2.8 Å
SCOPe Domain Sequences for d1nm3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nm3b2 c.47.1.10 (B:3-165) N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} smegkkvpqvtfrtrqgdkwvdvttselfdnktvivfslpgaftptcssshlprynelap vfkkygvddilvvsvndtfvmnawkedeksenisfipdgngeftegmgmlvgkedlgfgk rswrysmlvkngvvekmfiepnepgdpfkvsdadtmlkylapq
Timeline for d1nm3b2: