SCOPe 2.01: Domain d1n9fa_: 1n9f A:

Lineage for d1n9fa_ (1n9f A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (225 PDB entries)
   Uniprot P02185

8. Domain d1n9fa_: 1n9f A: [85465]
   complexed with hem, oh, so4; mutant

Details for d1n9fa_

PDB Entry: 1n9f, 1.8 Å

PDB Description: structure of earth-grown oxidized myoglobin mutant yqr (iss6a)

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1n9fa_:

Sequence; same for both SEQRES and ATOM records:

>d1n9fa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdiyirlfkshpetlekfdrfkhlkteaemkase
dlkkqgvrvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1n9fa_:

• d1n9fa_ first appeared in SCOP 1.65
  
• d1n9fa_ appears in SCOP 1.75
  
• d1n9fa_ appears in SCOPe 2.02
  
• d1n9fa_ appears in the current release, SCOPe 2.08