Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Myoglobin [46469] (9 species) |
Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (180 PDB entries) Uniprot P02185 |
Domain d1n9fa_: 1n9f A: [85465] complexed with hem, oh, sul; mutant |
PDB Entry: 1n9f (more details), 1.8 Å
SCOP Domain Sequences for d1n9fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n9fa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]} mvlsegewqlvlhvwakveadvaghgqdiyirlfkshpetlekfdrfkhlkteaemkase dlkkqgvrvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh pgnfgadaqgamnkalelfrkdiaakykelgyqg
Timeline for d1n9fa_: