SCOPe 2.02: Domain d1l6oc_: 1l6o C:

Lineage for d1l6oc_ (1l6o C:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (3 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [89314] (2 PDB entries)

8. Domain d1l6oc_: 1l6o C: [84536]
   complexed with a peptide from Daper 1, chains D, E and F

Details for d1l6oc_

PDB Entry: 1l6o, 2.2 Å

PDB Description: xenopus dishevelled pdz domain

PDB Compounds: (C:) Segment polarity protein dishevelled homolog DVL-2

SCOPe Domain Sequences for d1l6oc_:

Sequence; same for both SEQRES and ATOM records:

>d1l6oc_ b.36.1.1 (C:) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
miitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndi
nfenmsnddavrvlrdivhkpgpivltvakle

Timeline for d1l6oc_:

• d1l6oc_ first appeared in SCOP 1.65
  
• d1l6oc_ appears in SCOPe 2.01
  
• d1l6oc_ appears in SCOPe 2.03
  
• d1l6oc_ appears in the current release, SCOPe 2.08, called d1l6oc1