Class b: All beta proteins [48724] (174 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (3 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [89314] (2 PDB entries) |
Domain d1l6ob_: 1l6o B: [84535] complexed with a peptide from Daper 1, chains D, E and F |
PDB Entry: 1l6o (more details), 2.2 Å
SCOPe Domain Sequences for d1l6ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6ob_ b.36.1.1 (B:) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} miitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndi nfenmsnddavrvlrdivhkpgpivltvakleh
Timeline for d1l6ob_: