Lineage for d1jznd_ (1jzn D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001422Protein Galactose-specific C-type lectin [90061] (1 species)
  7. 3001423Species Western diamondback rattlesnake (Crotalus atrox) [TaxId:8730] [90062] (2 PDB entries)
  8. 3001427Domain d1jznd_: 1jzn D: [84265]
    complexed with ca, cl, na

Details for d1jznd_

PDB Entry: 1jzn (more details), 2.2 Å

PDB Description: crystal structure of a galactose-specific c-type lectin
PDB Compounds: (D:) Galactose-specific lectin

SCOPe Domain Sequences for d1jznd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jznd_ d.169.1.1 (D:) Galactose-specific C-type lectin {Western diamondback rattlesnake (Crotalus atrox) [TaxId: 8730]}
nncpldwlpmnglcykifnqlktwedaemfcrkykpgchlasfhrygesleiaeyisdyh
kgqenvwiglrdkkkdfswewtdrsctdyltwdknqpdhyqnkefcvelvsltgyrlwnd
qvceskdaflcqckf

SCOPe Domain Coordinates for d1jznd_:

Click to download the PDB-style file with coordinates for d1jznd_.
(The format of our PDB-style files is described here.)

Timeline for d1jznd_: