Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Galactose-specific C-type lectin [90061] (1 species) |
Species Western diamondback rattlesnake (Crotalus atrox) [TaxId:8730] [90062] (2 PDB entries) |
Domain d1jznd_: 1jzn D: [84265] complexed with ca, cl, na |
PDB Entry: 1jzn (more details), 2.2 Å
SCOPe Domain Sequences for d1jznd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jznd_ d.169.1.1 (D:) Galactose-specific C-type lectin {Western diamondback rattlesnake (Crotalus atrox) [TaxId: 8730]} nncpldwlpmnglcykifnqlktwedaemfcrkykpgchlasfhrygesleiaeyisdyh kgqenvwiglrdkkkdfswewtdrsctdyltwdknqpdhyqnkefcvelvsltgyrlwnd qvceskdaflcqckf
Timeline for d1jznd_:
View in 3D Domains from other chains: (mouse over for more information) d1jzna_, d1jznb_, d1jznc_, d1jzne_ |