Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein Proteasome alpha subunit (non-catalytic) [56255] (7 species) contains an extension to the common fold at the N-terminus |
Species Archaeoglobus fulgidus [TaxId:2234] [90044] (2 PDB entries) |
Domain d1j2pf_: 1j2p F: [84027] alpha-ring only |
PDB Entry: 1j2p (more details), 2.6 Å
SCOPe Domain Sequences for d1j2pf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j2pf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Archaeoglobus fulgidus [TaxId: 2234]} pqmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgskllekdt iekiykidehicaatsglvadarvlidrarieaqinrltydipitvkelakkicdfkqqy tqyggvrpfgvslliagvnevpklyetdpsgalleykataigmgrmavteffekeyrddl sfddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirel lkk
Timeline for d1j2pf_: