Lineage for d1j2pg_ (1j2p G:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1676715Protein Proteasome alpha subunit (non-catalytic) [56255] (7 species)
    contains an extension to the common fold at the N-terminus
  7. 1676716Species Archaeoglobus fulgidus [TaxId:2234] [90044] (2 PDB entries)
  8. 1676723Domain d1j2pg_: 1j2p G: [84028]
    alpha-ring only

Details for d1j2pg_

PDB Entry: 1j2p (more details), 2.6 Å

PDB Description: alpha-ring from the proteasome from archaeoglobus fulgidus
PDB Compounds: (G:) Proteasome alpha subunit

SCOPe Domain Sequences for d1j2pg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2pg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Archaeoglobus fulgidus [TaxId: 2234]}
pqmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgskllekdt
iekiykidehicaatsglvadarvlidrarieaqinrltydipitvkelakkicdfkqqy
tqyggvrpfgvslliagvnevpklyetdpsgalleykataigmgrmavteffekeyrddl
sfddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirel
lkk

SCOPe Domain Coordinates for d1j2pg_:

Click to download the PDB-style file with coordinates for d1j2pg_.
(The format of our PDB-style files is described here.)

Timeline for d1j2pg_: