Lineage for d1hjxd2 (1hjx D:261-328)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1899919Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1900344Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 1900345Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 1900442Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89884] (1 species)
  7. 1900443Species Human (Homo sapiens) [TaxId:9606] [89885] (7 PDB entries)
  8. 1900447Domain d1hjxd2: 1hjx D:261-328 [83519]
    Other proteins in same PDB: d1hjxa1, d1hjxb1, d1hjxc1, d1hjxd1
    complexed with gol, so4

Details for d1hjxd2

PDB Entry: 1hjx (more details), 1.85 Å

PDB Description: ligand-induced signalling and conformational change of the 39 kd glycoprotein from human articular chondrocytes
PDB Compounds: (D:) chitinase-3 like protein 1

SCOPe Domain Sequences for d1hjxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjxd2 d.26.3.1 (D:261-328) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]}
fgrsftlassetgvgapisgpgipgrftkeagtlayyeicdflrgatvhrilgqqvpyat
kgnqwvgy

SCOPe Domain Coordinates for d1hjxd2:

Click to download the PDB-style file with coordinates for d1hjxd2.
(The format of our PDB-style files is described here.)

Timeline for d1hjxd2: