Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.5: Type II chitinase [51534] (15 proteins) glycosylase family 18 |
Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89482] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89483] (7 PDB entries) |
Domain d1hjxb1: 1hjx B:22-260,B:329-383 [83514] Other proteins in same PDB: d1hjxa2, d1hjxb2, d1hjxc2, d1hjxd2 complexed with gol, so4 |
PDB Entry: 1hjx (more details), 1.85 Å
SCOPe Domain Sequences for d1hjxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hjxb1 c.1.8.5 (B:22-260,B:329-383) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]} yklvcyytswsqyregdgscfpdaldrflcthiiysfanisndhidtwewndvtlygmln tlknrnpnlktllsvggwnfgsqrfskiasntqsrrtfiksvppflrthgfdgldlawly pgrrdkqhfttlikemkaefikeaqpgkkqlllsaalsagkvtidssydiakisqhldfi simtydfhgawrgttghhsplfrgqedaspdrfsntdyavgymlrlgapasklvmgiptX ddqesvkskvqylkdrqlagamvwaldlddfqgsfcgqdlrfpltnaikdalaat
Timeline for d1hjxb1: