![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
![]() | Protein Mitochondrial NAD(P)-dependent malic enzyme [51898] (3 species) includes C-terminal additional subdomains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [51899] (10 PDB entries) |
![]() | Domain d1gz3a1: 1gz3 A:280-573 [83393] Other proteins in same PDB: d1gz3a2, d1gz3b2, d1gz3c2, d1gz3d2 complexed with atp, fum, mn, oxl |
PDB Entry: 1gz3 (more details), 2.3 Å
SCOPe Domain Sequences for d1gz3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gz3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani qevsiniaikvteylyankmafvypepedkakyvkeqtwrseydsllpdvyewp
Timeline for d1gz3a1: