Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.2: C-terminal domain of the electron transfer flavoprotein alpha subunit [52471] (1 protein) lacks strand 3; shares the FAD-binding mode with the pyruvate oxidase domain |
Protein C-terminal domain of the electron transfer flavoprotein alpha subunit [52472] (3 species) |
Species Methylophilus methylotrophus [TaxId:17] [82379] (2 PDB entries) |
Domain d1o96z2: 1o96 Z:196-318 [81231] Other proteins in same PDB: d1o96a_, d1o96b1, d1o96c_, d1o96d1, d1o96e_, d1o96f1, d1o96q_, d1o96z1 complexed with amp, fad |
PDB Entry: 1o96 (more details), 3.1 Å
SCOP Domain Sequences for d1o96z2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o96z2 c.31.1.2 (Z:196-318) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus} didittvdfimsigrgigeetnveqfreladeagatlccsrpiadagwlpksrqvgqsgk vvgscklyvamgisgsiqhmagmkhvptiiavntdpgasiftiakygivadifdieeelk aql
Timeline for d1o96z2: