SCOP 1.63: Domain d1o96z2: 1o96 Z:196-318

Lineage for d1o96z2 (1o96 Z:196-318)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.2: C-terminal domain of the electron transfer flavoprotein alpha subunit [52471] (1 protein)
   lacks strand 3; shares the FAD-binding mode with the pyruvate oxidase domain

6. Protein C-terminal domain of the electron transfer flavoprotein alpha subunit [52472] (3 species)

7. Species Methylophilus methylotrophus [TaxId:17] [82379] (2 PDB entries)

8. Domain d1o96z2: 1o96 Z:196-318 [81231]
   Other proteins in same PDB: d1o96a_, d1o96b1, d1o96c_, d1o96d1, d1o96e_, d1o96f1, d1o96q_, d1o96z1
   complexed with amp, fad

Details for d1o96z2

PDB Entry: 1o96, 3.1 Å

PDB Description: structure of electron transferring flavoprotein for methylophilus methylotrophus.

SCOP Domain Sequences for d1o96z2:

Sequence; same for both SEQRES and ATOM records:

>d1o96z2 c.31.1.2 (Z:196-318) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus}
didittvdfimsigrgigeetnveqfreladeagatlccsrpiadagwlpksrqvgqsgk
vvgscklyvamgisgsiqhmagmkhvptiiavntdpgasiftiakygivadifdieeelk
aql

Timeline for d1o96z2:

• d1o96z2 is new in SCOP 1.63
  
• d1o96z2 appears in SCOP 1.65
  
• d1o96z2 appears in the current release, SCOPe 2.08