SCOP 1.63: Domain d1o96z1: 1o96 Z:1-189

Lineage for d1o96z1 (1o96 Z:1-189)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families)
   share similar mode of ligand (Adenosine group) binding
   the first three families are more closely related to each other as the last two families are

5. Family c.26.2.3: ETFP subunits [52432] (2 proteins)
   alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet

6. Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species)
   contains an additional FAD-binding fomain of DHS-like fold

7. Species Methylophilus methylotrophus [TaxId:17] [82362] (4 PDB entries)

8. Domain d1o96z1: 1o96 Z:1-189 [81230]
   Other proteins in same PDB: d1o96a_, d1o96b2, d1o96c_, d1o96d2, d1o96e_, d1o96f2, d1o96q_, d1o96z2
   complexed with amp, fad

Details for d1o96z1

PDB Entry: 1o96, 3.1 Å

PDB Description: structure of electron transferring flavoprotein for methylophilus methylotrophus.

SCOP Domain Sequences for d1o96z1:

Sequence; same for both SEQRES and ATOM records:

>d1o96z1 c.26.2.3 (Z:1-189) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus}
skilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvdel
vvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvyi
veyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsvq
srsqnkdyv

Timeline for d1o96z1:

• d1o96z1 is new in SCOP 1.63
  
• d1o96z1 appears in SCOP 1.65
  
• d1o96z1 appears in the current release, SCOPe 2.08