Lineage for d1n36g_ (1n36 G:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215474Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 215475Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 215476Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 215477Protein Ribosomal protein S7 [47975] (3 species)
  7. 215482Species Thermus thermophilus [TaxId:274] [47977] (15 PDB entries)
  8. 215497Domain d1n36g_: 1n36 G: [79943]
    Other proteins in same PDB: d1n36b_, d1n36c1, d1n36c2, d1n36d_, d1n36e1, d1n36e2, d1n36f_, d1n36h_, d1n36i_, d1n36j_, d1n36k_, d1n36l_, d1n36m_, d1n36n_, d1n36o_, d1n36p_, d1n36q_, d1n36r_, d1n36s_, d1n36t_, d1n36v_
    complexed with zn

Details for d1n36g_

PDB Entry: 1n36 (more details), 3.65 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer RNA anticodon stem-loop mismatched at the second codon position

SCOP Domain Sequences for d1n36g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n36g_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOP Domain Coordinates for d1n36g_:

Click to download the PDB-style file with coordinates for d1n36g_.
(The format of our PDB-style files is described here.)

Timeline for d1n36g_: