Lineage for d1n36b_ (1n36 B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 241017Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 241713Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 241714Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 241715Protein Ribosomal protein S2 [52315] (1 species)
  7. 241716Species Thermus thermophilus [TaxId:274] [52316] (14 PDB entries)
  8. 241730Domain d1n36b_: 1n36 B: [79936]
    Other proteins in same PDB: d1n36c1, d1n36c2, d1n36d_, d1n36e1, d1n36e2, d1n36f_, d1n36g_, d1n36h_, d1n36i_, d1n36j_, d1n36k_, d1n36l_, d1n36m_, d1n36n_, d1n36o_, d1n36p_, d1n36q_, d1n36r_, d1n36s_, d1n36t_, d1n36v_
    complexed with zn

Details for d1n36b_

PDB Entry: 1n36 (more details), 3.65 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer RNA anticodon stem-loop mismatched at the second codon position

SCOP Domain Sequences for d1n36b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n36b_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq

SCOP Domain Coordinates for d1n36b_:

Click to download the PDB-style file with coordinates for d1n36b_.
(The format of our PDB-style files is described here.)

Timeline for d1n36b_: