Lineage for d1n0vd5 (1n0v D:726-842)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 329432Superfamily d.58.11: EF-G/eEF-2 domains III and V [54980] (1 family) (S)
  5. 329433Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
  6. 329434Protein Elongation factor 2 (eEF-2) [82677] (1 species)
  7. 329435Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (2 PDB entries)
  8. 329441Domain d1n0vd5: 1n0v D:726-842 [79771]
    Other proteins in same PDB: d1n0vc1, d1n0vc2, d1n0vc3, d1n0vd1, d1n0vd2, d1n0vd3

Details for d1n0vd5

PDB Entry: 1n0v (more details), 2.85 Å

PDB Description: crystal structure of elongation factor 2

SCOP Domain Sequences for d1n0vd5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0vd5 d.58.11.1 (D:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae)}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

SCOP Domain Coordinates for d1n0vd5:

Click to download the PDB-style file with coordinates for d1n0vd5.
(The format of our PDB-style files is described here.)

Timeline for d1n0vd5: