Lineage for d1mk9f2 (1mk9 F:309-398)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803543Family b.55.1.5: Third domain of FERM [50776] (8 proteins)
  6. 2803593Protein Talin [82144] (1 species)
  7. 2803594Species Chicken (Gallus gallus) [TaxId:9031] [82145] (7 PDB entries)
  8. 2803604Domain d1mk9f2: 1mk9 F:309-398 [79228]
    Other proteins in same PDB: d1mk9b1, d1mk9d1, d1mk9f1, d1mk9h1

Details for d1mk9f2

PDB Entry: 1mk9 (more details), 2.8 Å

PDB Description: crystal structure of an integrin beta3-talin chimera
PDB Compounds: (F:) Talin

SCOPe Domain Sequences for d1mk9f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mk9f2 b.55.1.5 (F:309-398) Talin {Chicken (Gallus gallus) [TaxId: 9031]}
gvsfflvkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftl
dfgdyqdgyysvqttegeqiaqliagyidi

SCOPe Domain Coordinates for d1mk9f2:

Click to download the PDB-style file with coordinates for d1mk9f2.
(The format of our PDB-style files is described here.)

Timeline for d1mk9f2: