Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.5: Third domain of FERM [50776] (8 proteins) |
Protein Talin [82144] (1 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [82145] (7 PDB entries) |
Domain d1mk9f2: 1mk9 F:309-398 [79228] Other proteins in same PDB: d1mk9b1, d1mk9d1, d1mk9f1, d1mk9h1 |
PDB Entry: 1mk9 (more details), 2.8 Å
SCOPe Domain Sequences for d1mk9f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mk9f2 b.55.1.5 (F:309-398) Talin {Chicken (Gallus gallus) [TaxId: 9031]} gvsfflvkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftl dfgdyqdgyysvqttegeqiaqliagyidi
Timeline for d1mk9f2: