SCOPe 2.05: Domain d1miwb1: 1miw B:140-404

Lineage for d1miwb1 (1miw B:140-404)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.173: Poly A polymerase C-terminal region-like [81890] (1 superfamily)
   multihelical; can be divided into three subdomains (neck, body and tail)

4. Superfamily a.173.1: Poly A polymerase C-terminal region-like [81891] (1 family)
   the neck subdomain is an alpha-alpha superhelix; the tail subdomain is similar to the RuvA C-terminal domain-like

5. Family a.173.1.1: Poly A polymerase C-terminal region-like [81892] (2 proteins)
   the 'neck' domain corresponds to the C-terminal part of Pfam PF01743

6. Protein tRNA CCA-adding enzyme, C-terminal domains [81893] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [81894] (3 PDB entries)

8. Domain d1miwb1: 1miw B:140-404 [79164]
   Other proteins in same PDB: d1miwa2, d1miwb2
   protein/RNA complex; complexed with atp, mg

Details for d1miwb1

PDB Entry: 1miw, 3 Å

PDB Description: Crystal structure of Bacillus stearothermophilus CCA-adding enzyme in complex with ATP

PDB Compounds: (B:) tRNA CCA-adding enzyme

SCOPe Domain Sequences for d1miwb1:

Sequence; same for both SEQRES and ATOM records:

>d1miwb1 a.173.1.1 (B:140-404) tRNA CCA-adding enzyme, C-terminal domains {Bacillus stearothermophilus [TaxId: 1422]}
iirtvgeaekrfredalrmmravrfvselgfalapdteqaivqnapllahisvermtmem
ekllggpfaaralpllaetglnaylpglagkekqlrlaaayrwpwlaareerwallchal
gvqesrpflrawklpnkvvdeagailtaladiprpeawtneqlfsagleralsvetvraa
ftgappgpwheklrrrfaslpiktkgelavngkdviewvgkpagpwvkealdaiwravvn
gevenekeriyawlmernrtreknc

Timeline for d1miwb1:

• d1miwb1 first appeared in SCOP 1.63
  
• d1miwb1 appears in SCOPe 2.04
  
• d1miwb1 appears in SCOPe 2.06
  
• d1miwb1 appears in the current release, SCOPe 2.08