SCOP 1.63: Domain d1miwb1: 1miw B:140-404

Lineage for d1miwb1 (1miw B:140-404)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.173: tRNA CCA-adding enzyme, C-terminal domains [81890] (1 superfamily)
   multihelical; can be divided into three subdomains (neck, body and tail)

4. Superfamily a.173.1: tRNA CCA-adding enzyme, C-terminal domains [81891] (1 family)
   the neck subdomain is an alpha-alpha superhelix; the tail subdomain is similar to the RuvA C-terminal domain-like

5. Family a.173.1.1: tRNA CCA-adding enzyme, C-terminal domains [81892] (1 protein)

6. Protein tRNA CCA-adding enzyme, C-terminal domains [81893] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [81894] (3 PDB entries)

8. Domain d1miwb1: 1miw B:140-404 [79164]
   Other proteins in same PDB: d1miwa2, d1miwb2
   complexed with atp, mg, mse

Details for d1miwb1

PDB Entry: 1miw, 3 Å

PDB Description: Crystal structure of Bacillus stearothermophilus CCA-adding enzyme in complex with ATP

SCOP Domain Sequences for d1miwb1:

Sequence; same for both SEQRES and ATOM records:

>d1miwb1 a.173.1.1 (B:140-404) tRNA CCA-adding enzyme, C-terminal domains {Bacillus stearothermophilus}
iirtvgeaekrfredalrmmravrfvselgfalapdteqaivqnapllahisvermtmem
ekllggpfaaralpllaetglnaylpglagkekqlrlaaayrwpwlaareerwallchal
gvqesrpflrawklpnkvvdeagailtaladiprpeawtneqlfsagleralsvetvraa
ftgappgpwheklrrrfaslpiktkgelavngkdviewvgkpagpwvkealdaiwravvn
gevenekeriyawlmernrtreknc

Timeline for d1miwb1:

• d1miwb1 is new in SCOP 1.63
  
• d1miwb1 appears in SCOP 1.65
  
• d1miwb1 appears in the current release, SCOPe 2.08