Lineage for d1mgvb_ (1mgv B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896011Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2896102Protein Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA [53438] (2 species)
    synonym: 7,8-diaminopelargonic acid synthase
  7. 2896108Species Escherichia coli [TaxId:562] [53439] (11 PDB entries)
  8. 2896124Domain d1mgvb_: 1mgv B: [79108]
    complexed with ipa, na, plp; mutant

Details for d1mgvb_

PDB Entry: 1mgv (more details), 2.1 Å

PDB Description: crystal structure of the r391a mutant of 7,8-diaminopelargonic acid synthase
PDB Compounds: (B:) 7,8-diamino-pelargonic acid aminotransferase

SCOPe Domain Sequences for d1mgvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mgvb_ c.67.1.4 (B:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]}
mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
lliadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
vlgaigvvetthpvnmaalqkffveqgvwiapfgkliylmppyiilpqqlqrltaavnra
vqdetffc

SCOPe Domain Coordinates for d1mgvb_:

Click to download the PDB-style file with coordinates for d1mgvb_.
(The format of our PDB-style files is described here.)

Timeline for d1mgvb_: