Lineage for d1lxha_ (1lxh A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1962063Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1962064Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1962065Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 1962066Protein alpha-Cobratoxin [57318] (3 species)
  7. 1962078Species Monocled cobra (Naja naja kaouthia) [TaxId:8649] [82899] (2 PDB entries)
    identical sequence to the Naja naja siamensis toxin
  8. 1962080Domain d1lxha_: 1lxh A: [78295]
    complexed to a cognate peptide, chain B

Details for d1lxha_

PDB Entry: 1lxh (more details)

PDB Description: solution structure of alpha-cobratoxin complexed with a cognate peptide (minimized average structure)
PDB Compounds: (A:) long neurotoxin 1

SCOPe Domain Sequences for d1lxha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxha_ g.7.1.1 (A:) alpha-Cobratoxin {Monocled cobra (Naja naja kaouthia) [TaxId: 8649]}
ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
ncnpfptrkrp

SCOPe Domain Coordinates for d1lxha_:

Click to download the PDB-style file with coordinates for d1lxha_.
(The format of our PDB-style files is described here.)

Timeline for d1lxha_: