PDB entry 1lxh

View 1lxh on RCSB PDB site
Description: Solution structure of alpha-cobratoxin complexed with a cognate peptide (minimized average structure)
Class: toxin
Keywords: toxin,alpha-cobratoxin, nicotinic acetylcholine receptor, protein-protein interaction
Deposited on 2002-06-05, released 2002-11-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: long neurotoxin 1
  Species: Naja kaouthia [TaxId:8649]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01391 (0-70)
  Domains in SCOPe 2.05: d1lxha_
• Chain 'B':
  Compound: acetylcholine receptor protein, alpha chain
  Species: Torpedo californica [TaxId:7787]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02710 (0-17)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lxhA (A:)
  ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
  ncnpfptrkrp
  

  
  
• Chain 'B':
  No sequence available.