![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins) |
![]() | Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species) |
![]() | Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [54460] (11 PDB entries) |
![]() | Domain d1lo5a2: 1lo5 A:4-81 [78117] Other proteins in same PDB: d1lo5a1, d1lo5b1, d1lo5d1, d1lo5d2 |
PDB Entry: 1lo5 (more details), 3.2 Å
SCOP Domain Sequences for d1lo5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lo5a2 d.19.1.1 (A:4-81) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1} ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani avdkanleimtkrsnytp
Timeline for d1lo5a2:
![]() Domains from other chains: (mouse over for more information) d1lo5b1, d1lo5b2, d1lo5d1, d1lo5d2 |