Lineage for d1lo5d1 (1lo5 D:1-120)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 228613Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 228945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 228946Protein Staphylococcal enterotoxin A, SEA [50220] (1 species)
  7. 228947Species Staphylococcus aureus [TaxId:1280] [50221] (6 PDB entries)
  8. 228956Domain d1lo5d1: 1lo5 D:1-120 [78120]
    Other proteins in same PDB: d1lo5a1, d1lo5a2, d1lo5b1, d1lo5b2, d1lo5d2
    mutant

Details for d1lo5d1

PDB Entry: 1lo5 (more details), 3.2 Å

PDB Description: crystal structure of the d227a variant of staphylococcal enterotoxin a in complex with human mhc class ii
PDB Compounds: (D:)

SCOP Domain Sequences for d1lo5d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo5d1 b.40.2.2 (D:1-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
sekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftd
hswyndllvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

SCOP Domain Coordinates for d1lo5d1:

Click to download the PDB-style file with coordinates for d1lo5d1.
(The format of our PDB-style files is described here.)

Timeline for d1lo5d1: