SCOP 1.65: Domain d1lo5a2: 1lo5 A:4-81

Lineage for d1lo5a2 (1lo5 A:4-81)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (13 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (11 PDB entries)

8. Domain d1lo5a2: 1lo5 A:4-81 [78117]
   Other proteins in same PDB: d1lo5a1, d1lo5b1, d1lo5b2, d1lo5d1, d1lo5d2
   complexed with a peptide from hemagglutinin
   mutant

Details for d1lo5a2

PDB Entry: 1lo5, 3.2 Å

PDB Description: crystal structure of the d227a variant of staphylococcal enterotoxin a in complex with human mhc class ii

SCOP Domain Sequences for d1lo5a2:

Sequence; same for both SEQRES and ATOM records:

>d1lo5a2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

Timeline for d1lo5a2:

• d1lo5a2 first appeared in SCOP 1.63
  
• d1lo5a2 appears in SCOP 1.67
  
• d1lo5a2 appears in the current release, SCOPe 2.08