SCOPe 2.02: Domain d1lnwg_: 1lnw G:

Lineage for d1lnwg_ (1lnw G:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein MexR repressor [81686] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [81687] (3 PDB entries)

8. Domain d1lnwg_: 1lnw G: [78110]

Details for d1lnwg_

PDB Entry: 1lnw, 2.1 Å

PDB Description: crystal structure of the mexr repressor of the mexab-oprm multidrug efflux operon of pseudomonas aeruginosa

PDB Compounds: (G:) Multidrug resistance operon repressor

SCOPe Domain Sequences for d1lnwg_:

Sequence, based on SEQRES records:

>d1lnwg_ a.4.5.28 (G:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]}
pvnpdlmpalmavfqhvrtriqseldcqrldltppdvhvlklideqrglnlqdlgrqmcr
dkalitrkirelegrnlvrrernpsdqrsfqlfltdeglaihqhaeaimsrvhdelfapl
tpveqatlvhlldqclaa

Sequence, based on observed residues (ATOM records):

>d1lnwg_ a.4.5.28 (G:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]}
pvnpdlmpalmavfqhvrtriqseldcqrldltppdvhvlklideqrglnlqdlgrqmcr
dkalitrkirelegrnlvrrernrsfqlfltdeglaihqhaeaimsrvhdelfapltpve
qatlvhlldqclaa

Timeline for d1lnwg_:

• d1lnwg_ first appeared in SCOP 1.63
  
• d1lnwg_ appears in SCOPe 2.01
  
• d1lnwg_ appears in SCOPe 2.03
  
• d1lnwg_ appears in the current release, SCOPe 2.08