Lineage for d1l9eb1 (1l9e B:1-217,B:322-385)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 309374Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 309375Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 309426Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (11 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 309545Protein Sarcosine oxidase [51920] (1 species)
  7. 309546Species Bacillus sp., strain b0618 [TaxId:1409] [51921] (9 PDB entries)
  8. 309548Domain d1l9eb1: 1l9e B:1-217,B:322-385 [77825]
    Other proteins in same PDB: d1l9ea2, d1l9eb2
    complexed with cl, fad, imd

Details for d1l9eb1

PDB Entry: 1l9e (more details), 1.85 Å

PDB Description: role of histidine 269 in catalysis by monomeric sarcosine oxidase

SCOP Domain Sequences for d1l9eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9eb1 c.3.1.2 (B:1-217,B:322-385) Sarcosine oxidase {Bacillus sp., strain b0618}
sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
dsvkietangsytadklivsmgawnskllsklnldipXdehfiidlhpehsnvviaagfs
ghgfkfssgvgevlsqlaltgktehdisifsinrpalkeslq

SCOP Domain Coordinates for d1l9eb1:

Click to download the PDB-style file with coordinates for d1l9eb1.
(The format of our PDB-style files is described here.)

Timeline for d1l9eb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l9eb2