SCOP 1.65: Domain d1l9eb2: 1l9e B:218-321

Lineage for d1l9eb2 (1l9e B:218-321)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins)

6. Protein Sarcosine oxidase [54388] (1 species)

7. Species Bacillus sp., strain b0618 [TaxId:1409] [54389] (9 PDB entries)

8. Domain d1l9eb2: 1l9e B:218-321 [77826]
   Other proteins in same PDB: d1l9ea1, d1l9eb1
   complexed with cl, fad, imd

Details for d1l9eb2

PDB Entry: 1l9e, 1.85 Å

PDB Description: role of histidine 269 in catalysis by monomeric sarcosine oxidase

SCOP Domain Sequences for d1l9eb2:

Sequence; same for both SEQRES and ATOM records:

>d1l9eb2 d.16.1.3 (B:218-321) Sarcosine oxidase {Bacillus sp., strain b0618}
lqpyrqvvgffesdeskysndidfpgfmvevpngiyygfpsfggcglklgyhtfgqkidp
dtinrefgvypedesnlrafleeympgangelkrgavcmytktl

Timeline for d1l9eb2:

• d1l9eb2 first appeared in SCOP 1.63
  
• d1l9eb2 appears in SCOP 1.67
  
• d1l9eb2 appears in the current release, SCOPe 2.08