SCOP 1.65: Domain d1iwpg_: 1iwp G:

Lineage for d1iwpg_ (1iwp G:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family)
   contains irregular N-terminal subdomain

5. Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (1 protein)

6. Protein Diol dehydratase, gamma subunit [47150] (2 species)

7. Species Klebsiella pneumoniae [TaxId:573] [81728] (2 PDB entries)

8. Domain d1iwpg_: 1iwp G: [76887]
   Other proteins in same PDB: d1iwpa_, d1iwpb_, d1iwpe_, d1iwpl_

Details for d1iwpg_

PDB Entry: 1iwp, 2.1 Å

PDB Description: Glycerol Dehydratase-cyanocobalamin Complex of Klebsiella pneumoniae

SCOP Domain Sequences for d1iwpg_:

Sequence; same for both SEQRES and ATOM records:

>d1iwpg_ a.23.2.1 (G:) Diol dehydratase, gamma subunit {Klebsiella pneumoniae}
ktmrvqdyplatrcpehiltptgkpltditlekvlsgevgpqdvrisrqtleyqaqiaeq
mqrhavarnfrraaeliaipderilaiynalrpfrssqaellaiadelehtwhatvnaaf
vresaevyqqrhklrkgs

Timeline for d1iwpg_:

• d1iwpg_ first appeared in SCOP 1.63
  
• d1iwpg_ appears in SCOP 1.67
  
• d1iwpg_ appears in the current release, SCOPe 2.08