Lineage for d1iwpb_ (1iwp B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316208Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 316305Superfamily c.51.3: B12-dependend dehydatases associated subunit [52968] (2 families) (S)
  5. 316306Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein)
    contains additional structures in the C-terminal extension
  6. 316307Protein Diol dehydratase, beta subunit [52970] (2 species)
  7. 316323Species Klebsiella pneumoniae [TaxId:573] [82432] (2 PDB entries)
  8. 316324Domain d1iwpb_: 1iwp B: [76885]
    Other proteins in same PDB: d1iwpa_, d1iwpg_, d1iwpl_, d1iwpm_

Details for d1iwpb_

PDB Entry: 1iwp (more details), 2.1 Å

PDB Description: Glycerol Dehydratase-cyanocobalamin Complex of Klebsiella pneumoniae

SCOP Domain Sequences for d1iwpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iwpb_ c.51.3.1 (B:) Diol dehydratase, beta subunit {Klebsiella pneumoniae}
ftlktreggvasaderadevvigvgpafdkhqhhtlidmphgailkeliagveeeglhar
vvrilrtsdvsfmawdaanlsgsgigigiqskgttvihqrdllplsnlelfsqaplltle
tyrqigknaaryarkespspvpvvndqmvrpkfmakaalfhiketkhvvqdaepvtlhid
lvre

SCOP Domain Coordinates for d1iwpb_:

Click to download the PDB-style file with coordinates for d1iwpb_.
(The format of our PDB-style files is described here.)

Timeline for d1iwpb_: