SCOP 1.65: Domain d1iwpe_: 1iwp E:

Lineage for d1iwpe_ (1iwp E:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.3: B12-dependend dehydatases associated subunit [52968] (2 families)

5. Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein)
   contains additional structures in the C-terminal extension

6. Protein Diol dehydratase, beta subunit [52970] (2 species)

7. Species Klebsiella pneumoniae [TaxId:573] [82432] (2 PDB entries)

8. Domain d1iwpe_: 1iwp E: [76886]
   Other proteins in same PDB: d1iwpa_, d1iwpg_, d1iwpl_, d1iwpm_
   complexed with b12, k, pgo

Details for d1iwpe_

PDB Entry: 1iwp, 2.1 Å

PDB Description: Glycerol Dehydratase-cyanocobalamin Complex of Klebsiella pneumoniae

SCOP Domain Sequences for d1iwpe_:

Sequence; same for both SEQRES and ATOM records:

>d1iwpe_ c.51.3.1 (E:) Diol dehydratase, beta subunit {Klebsiella pneumoniae}
ftlktreggvasaderadevvigvgpafdkhqhhtlidmphgailkeliagveeeglhar
vvrilrtsdvsfmawdaanlsgsgigigiqskgttvihqrdllplsnlelfsqaplltle
tyrqigknaaryarkespspvpvvndqmvrpkfmakaalfhiketkhvvqdaepvtlhid
lvre

Timeline for d1iwpe_:

• d1iwpe_ first appeared in SCOP 1.63
  
• d1iwpe_ appears in SCOP 1.67
  
• d1iwpe_ appears in the current release, SCOPe 2.08