Lineage for d1is6a_ (1is6 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779190Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2779202Protein Congerin II [82034] (1 species)
  7. 2779203Species Conger eel (Conger myriaster) [TaxId:7943] [82035] (4 PDB entries)
  8. 2779205Domain d1is6a_: 1is6 A: [76776]
    complexed with mes

Details for d1is6a_

PDB Entry: 1is6 (more details), 1.7 Å

PDB Description: MES-Liganded Congerin II
PDB Compounds: (A:) Congerin II

SCOPe Domain Sequences for d1is6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1is6a_ b.29.1.3 (A:) Congerin II {Conger eel (Conger myriaster) [TaxId: 7943]}
draevrnipfklgmyltvggvvnsnatrfsinvgestdsiamhmdhrfsygadqnvlvln
slvhnvgwqqeerskkfpftkgdhfqttitfdthtfyiqlsngetvefpnrnkdaafnli
ylagdarltfvrle

SCOPe Domain Coordinates for d1is6a_:

Click to download the PDB-style file with coordinates for d1is6a_.
(The format of our PDB-style files is described here.)

Timeline for d1is6a_: