Lineage for d1h3ea2 (1h3e A:352-432)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1655967Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 1655968Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 1656053Family d.66.1.4: Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain [75465] (1 protein)
    there are additional N-terminal structures
  6. 1656054Protein Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain [75466] (2 species)
  7. 1656057Species Thermus thermophilus [TaxId:274] [82701] (2 PDB entries)
  8. 1656060Domain d1h3ea2: 1h3e A:352-432 [76630]
    Other proteins in same PDB: d1h3ea1
    protein/RNA complex; complexed with atp, tye

Details for d1h3ea2

PDB Entry: 1h3e (more details), 2.9 Å

PDB Description: tyrosyl-trna synthetase from thermus thermophilus complexed with wild- type trnatyr(gua) and with atp and tyrosinol
PDB Compounds: (A:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d1h3ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3ea2 d.66.1.4 (A:352-432) Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain {Thermus thermophilus [TaxId: 274]}
eeipevtipaselkegriwvarlftlagltpsnaearrliqnrglrldgevltdpmlqvd
lsrprilqrgkdrfvrvrlsd

SCOPe Domain Coordinates for d1h3ea2:

Click to download the PDB-style file with coordinates for d1h3ea2.
(The format of our PDB-style files is described here.)

Timeline for d1h3ea2: