SCOPe 2.05: Domain d1h3ea2: 1h3e A:352-432

Lineage for d1h3ea2 (1h3e A:352-432)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
   alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta

4. Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families)
   common motif in otherwise different folds

5. Family d.66.1.4: Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain [75465] (1 protein)
   there are additional N-terminal structures

6. Protein Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain [75466] (2 species)

7. Species Thermus thermophilus [TaxId:274] [82701] (2 PDB entries)

8. Domain d1h3ea2: 1h3e A:352-432 [76630]
   Other proteins in same PDB: d1h3ea1
   protein/RNA complex; complexed with atp, tye

Details for d1h3ea2

PDB Entry: 1h3e, 2.9 Å

PDB Description: tyrosyl-trna synthetase from thermus thermophilus complexed with wild- type trnatyr(gua) and with atp and tyrosinol

PDB Compounds: (A:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d1h3ea2:

Sequence; same for both SEQRES and ATOM records:

>d1h3ea2 d.66.1.4 (A:352-432) Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain {Thermus thermophilus [TaxId: 274]}
eeipevtipaselkegriwvarlftlagltpsnaearrliqnrglrldgevltdpmlqvd
lsrprilqrgkdrfvrvrlsd

Timeline for d1h3ea2:

• d1h3ea2 first appeared in SCOP 1.63
  
• d1h3ea2 appears in SCOPe 2.04
  
• d1h3ea2 appears in SCOPe 2.06
  
• d1h3ea2 appears in the current release, SCOPe 2.08