SCOPe 2.04: Domain d1h3ea1: 1h3e A:6-351

Lineage for d1h3ea1 (1h3e A:6-351)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein Tyrosyl-tRNA synthetase (TyrRS) [52376] (6 species)

7. Species Thermus thermophilus [TaxId:274] [82354] (2 PDB entries)

8. Domain d1h3ea1: 1h3e A:6-351 [76629]
   Other proteins in same PDB: d1h3ea2
   protein/RNA complex; complexed with atp, tye

Details for d1h3ea1

PDB Entry: 1h3e, 2.9 Å

PDB Description: tyrosyl-trna synthetase from thermus thermophilus complexed with wild- type trnatyr(gua) and with atp and tyrosinol

PDB Compounds: (A:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d1h3ea1:

Sequence; same for both SEQRES and ATOM records:

>d1h3ea1 c.26.1.1 (A:6-351) Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophilus [TaxId: 274]}
htpeealallkrgaeeivpeeellaklkegrpltvklgadptrpdlhlghavvlrkmrqf
qelghkvvliigdftgmigdpsgrsktrppltleetrenaktyvaqagkilrqephlfel
rynsewlegltfkevvrltslmtvaqmleredfkkryeagipislhellypfaqaydsva
iradvemggtdqrfnllvgrevqraygqspqvcflmpllvgldgrekmsksldnyiglte
ppeamfkklmrvpdpllpsyfrlltdleeeeieallkagpvpahrvlarlltaayalpqi
ppridrafyeslgyaweafgrdkeagpeevrraearydevakggip

Timeline for d1h3ea1:

• d1h3ea1 first appeared in SCOP 1.63
  
• d1h3ea1 appears in SCOPe 2.03
  
• d1h3ea1 appears in SCOPe 2.05
  
• d1h3ea1 appears in the current release, SCOPe 2.08