Lineage for d1h2ub3 (1h2u B:481-790)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1095602Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1095603Superfamily a.118.1: ARM repeat [48371] (24 families) (S)
  5. 1095833Family a.118.1.14: MIF4G domain-like [100908] (5 proteins)
    duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
    this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain
  6. 1095834Protein CBP80, 80KDa nuclear cap-binding protein [63606] (1 species)
    contains three domains of this fold connected with long linkers
  7. 1095835Species Human (Homo sapiens) [TaxId:9606] [63607] (6 PDB entries)
  8. 1095859Domain d1h2ub3: 1h2u B:481-790 [76589]
    Other proteins in same PDB: d1h2ux_, d1h2uy_
    protein/RNA complex; complexed with 7mg, gdp

Details for d1h2ub3

PDB Entry: 1h2u (more details), 2.4 Å

PDB Description: structure of the human nuclear cap-binding-complex (cbc) in complex with a cap analogue m7gpppg
PDB Compounds: (B:) 80 kda nuclear cap binding protein

SCOPe Domain Sequences for d1h2ub3:

Sequence, based on SEQRES records: (download)

>d1h2ub3 a.118.1.14 (B:481-790) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}
ptciykygdessnslpghsvalclavafkskatndeifsilkdvpnpnqdddddegfsfn
plkievfvqtllhlaaksfshsfsalakfhevfktlaesdegklhvlrvmfevwrnhpqm
iavlvdkmirtqivdcaavanwifsselsrdftrlfvweilhstirkmnkhvgaqseqkn
lflvifqrfimiltehlvrcetdgtsvltpwykncierlqqiflqhhqiiqqymvtlenl
lftaeldphilavfqqfcalqa

Sequence, based on observed residues (ATOM records): (download)

>d1h2ub3 a.118.1.14 (B:481-790) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}
ptciykygdessnslpghsvalclavafkskatndeifsilkdvpnpsfnplkievfvqt
llhlaaksfshsfsalakfhevfktlaesdegklhvlrvmfevwrnhpqmiavlvdkmir
tqivdcaavanwifsselsrdftrlfvweilhstirkmnkhvgaqseqknlflvifqrfi
miltehlvrcetdgtsvltpwykncierlqqiflqhhqiiqqymvtlenllftaeldphi
lavfqqfcalqa

SCOPe Domain Coordinates for d1h2ub3:

Click to download the PDB-style file with coordinates for d1h2ub3.
(The format of our PDB-style files is described here.)

Timeline for d1h2ub3: