![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (24 families) ![]() |
![]() | Family a.118.1.14: MIF4G domain-like [100908] (5 proteins) duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain |
![]() | Protein CBP80, 80KDa nuclear cap-binding protein [63606] (1 species) contains three domains of this fold connected with long linkers |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63607] (6 PDB entries) |
![]() | Domain d1h2ua3: 1h2u A:481-790 [76586] Other proteins in same PDB: d1h2ux_, d1h2uy_ protein/RNA complex; complexed with 7mg, gdp |
PDB Entry: 1h2u (more details), 2.4 Å
SCOPe Domain Sequences for d1h2ua3:
Sequence, based on SEQRES records: (download)
>d1h2ua3 a.118.1.14 (A:481-790) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} ptciykygdessnslpghsvalclavafkskatndeifsilkdvpnpnqdddddegfsfn plkievfvqtllhlaaksfshsfsalakfhevfktlaesdegklhvlrvmfevwrnhpqm iavlvdkmirtqivdcaavanwifsselsrdftrlfvweilhstirkmnkhvgaqseqkn lflvifqrfimiltehlvrcetdgtsvltpwykncierlqqiflqhhqiiqqymvtlenl lftaeldphilavfqqfcalqa
>d1h2ua3 a.118.1.14 (A:481-790) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} ptciykygdessnslpghsvalclavafkskatndeifsilkdvpnpfnplkievfvqtl lhlaaksfshsfsalakfhevfktlaesdegklhvlrvmfevwrnhpqmiavlvdkmirt qivdcaavanwifsselsrdftrlfvweilhstirkmnkhvgaqseqknlflvifqrfim iltehlvrcetdgtsvltpwykncierlqqiflqhhqiiqqymvtlenllftaeldphil avfqqfcalqa
Timeline for d1h2ua3: