Lineage for d1gnga_ (1gng A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1930514Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species)
    CMGC group; GSK3 subfamily; serine/threonine kinase
  7. 1930515Species Human (Homo sapiens) [TaxId:9606] [69824] (38 PDB entries)
    Uniprot P49841 35-383 ! Uniprot P49841 35-384
  8. 1930557Domain d1gnga_: 1gng A: [76239]
    complexed with so4, trs

Details for d1gnga_

PDB Entry: 1gng (more details), 2.6 Å

PDB Description: glycogen synthase kinase-3 beta (gsk3) complex with frattide peptide
PDB Compounds: (A:) Glycogen synthase kinase-3 beta

SCOPe Domain Sequences for d1gnga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gnga_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}
kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfkn
relqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpv
iyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvs
yicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgt
ptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleac
ahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariq

SCOPe Domain Coordinates for d1gnga_:

Click to download the PDB-style file with coordinates for d1gnga_.
(The format of our PDB-style files is described here.)

Timeline for d1gnga_: