SCOPe 2.04: Domain d1gnga_: 1gng A:

Lineage for d1gnga_ (1gng A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species)
   CMGC group; GSK3 subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [69824] (35 PDB entries)
   Uniprot P49841 35-383 ! Uniprot P49841 35-384

8. Domain d1gnga_: 1gng A: [76239]
   complexed with so4, trs

Details for d1gnga_

PDB Entry: 1gng, 2.6 Å

PDB Description: glycogen synthase kinase-3 beta (gsk3) complex with frattide peptide

PDB Compounds: (A:) Glycogen synthase kinase-3 beta

SCOPe Domain Sequences for d1gnga_:

Sequence; same for both SEQRES and ATOM records:

>d1gnga_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}
kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfkn
relqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpv
iyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvs
yicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgt
ptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleac
ahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariq

Timeline for d1gnga_:

• d1gnga_ first appeared in SCOP 1.63
  
• d1gnga_ appears in SCOPe 2.03
  
• d1gnga_ appears in SCOPe 2.05
  
• d1gnga_ appears in the current release, SCOPe 2.08