Lineage for d1epva1 (1epv A:2-11,A:245-383)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798988Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 2798989Family b.49.2.2: Alanine racemase-like, C-terminal domain [88682] (2 proteins)
  6. 2798990Protein Alanine racemase [50623] (3 species)
  7. 2798991Species Bacillus stearothermophilus [TaxId:1422] [50624] (8 PDB entries)
  8. 2799002Domain d1epva1: 1epv A:2-11,A:245-383 [76146]
    Other proteins in same PDB: d1epva2, d1epvb2
    complexed with dcs

Details for d1epva1

PDB Entry: 1epv (more details), 2.2 Å

PDB Description: alanine racemase with bound inhibitor derived from d-cycloserine
PDB Compounds: (A:) alanine racemase

SCOPe Domain Sequences for d1epva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1epva1 b.49.2.2 (A:2-11,A:245-383) Alanine racemase {Bacillus stearothermophilus [TaxId: 1422]}
ndfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlq
hfhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletin
yevpctisyrvpriffrhkrimevrnaigr

SCOPe Domain Coordinates for d1epva1:

Click to download the PDB-style file with coordinates for d1epva1.
(The format of our PDB-style files is described here.)

Timeline for d1epva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1epva2