Lineage for d2bpgb3 (2bpg B:92-148)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1090417Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1091050Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1091051Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
  6. 1091052Protein DNA polymerase beta [81579] (2 species)
  7. 1091161Species Norway rat (Rattus norvegicus) [TaxId:10116] [81577] (18 PDB entries)
  8. 1091181Domain d2bpgb3: 2bpg B:92-148 [75995]
    Other proteins in same PDB: d2bpga1, d2bpga4, d2bpgb1, d2bpgb4
    protein/DNA complex; complexed with dct, mg

Details for d2bpgb3

PDB Entry: 2bpg (more details), 3.6 Å

PDB Description: structures of ternary complexes of rat dna polymerase beta, a dna template-primer, and ddctp
PDB Compounds: (B:) DNA polymerase beta

SCOPe Domain Sequences for d2bpgb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bpgb3 a.60.12.1 (B:92-148) DNA polymerase beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

SCOPe Domain Coordinates for d2bpgb3:

Click to download the PDB-style file with coordinates for d2bpgb3.
(The format of our PDB-style files is described here.)

Timeline for d2bpgb3: