SCOPe 2.01: Domain d2bpgb3: 2bpg B:92-148

Lineage for d2bpgb3 (2bpg B:92-148)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [81577] (18 PDB entries)

8. Domain d2bpgb3: 2bpg B:92-148 [75995]
   Other proteins in same PDB: d2bpga1, d2bpga4, d2bpgb1, d2bpgb4
   protein/DNA complex; complexed with dct, mg

Details for d2bpgb3

PDB Entry: 2bpg, 3.6 Å

PDB Description: structures of ternary complexes of rat dna polymerase beta, a dna template-primer, and ddctp

PDB Compounds: (B:) DNA polymerase beta

SCOPe Domain Sequences for d2bpgb3:

Sequence; same for both SEQRES and ATOM records:

>d2bpgb3 a.60.12.1 (B:92-148) DNA polymerase beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

Timeline for d2bpgb3:

• d2bpgb3 first appeared in SCOP 1.63
  
• d2bpgb3 appears in SCOP 1.75
  
• d2bpgb3 appears in SCOPe 2.02
  
• d2bpgb3 appears in the current release, SCOPe 2.08