Class a: All alpha proteins [46456] (284 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families) contains one classic and one pseudo HhH motifs |
Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins) topological similarity to the N-terminal domain |
Protein DNA polymerase beta [81579] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [81577] (18 PDB entries) |
Domain d2bpga3: 2bpg A:92-148 [75993] Other proteins in same PDB: d2bpga1, d2bpga4, d2bpgb1, d2bpgb4 |
PDB Entry: 2bpg (more details), 3.6 Å
SCOP Domain Sequences for d2bpga3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bpga3 a.60.12.1 (A:92-148) DNA polymerase beta {Rat (Rattus norvegicus) [TaxId: 10116]} dtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek
Timeline for d2bpga3: