SCOP 1.63: Domain d2bpga3: 2bpg A:92-148

Lineage for d2bpga3 (2bpg A:92-148)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (2 proteins)
   topological similarity to the N-terminal domain

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [81577] (17 PDB entries)

8. Domain d2bpga3: 2bpg A:92-148 [75993]
   Other proteins in same PDB: d2bpga1, d2bpga4, d2bpgb1, d2bpgb4

Details for d2bpga3

PDB Entry: 2bpg, 3.6 Å

PDB Description: structures of ternary complexes of rat dna polymerase beta, a dna template-primer, and ddctp

SCOP Domain Sequences for d2bpga3:

Sequence; same for both SEQRES and ATOM records:

>d2bpga3 a.60.12.1 (A:92-148) DNA polymerase beta {Rat (Rattus norvegicus)}
dtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

Timeline for d2bpga3:

• d2bpga3 is new in SCOP 1.63
  
• d2bpga3 appears in SCOP 1.65
  
• d2bpga3 appears in the current release, SCOPe 2.08